SCOPe 2.08: Domain d2hx0a2: 2hx0 A:5-141

Lineage for d2hx0a2 (2hx0 A:5-141)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily)
   duplication: consists of two similar beta-alpha-beta(4) motifs

4. Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families)
   characteristic metal ion (zinc)-binding motif in the putative active site

5. Family d.290.1.3: AF0104-like [143094] (3 proteins)
   Pfam PF03479; DUF296; PD1 domain; plant- and prokaryote conserved (PPC; see new PDB 2DT4)

6. Protein automated matches [190677] (2 species)
   not a true protein

7. Species Salmonella enterica [TaxId:28901] [187830] (1 PDB entry)

8. Domain d2hx0a2: 2hx0 A:5-141 [136830]
   Other proteins in same PDB: d2hx0a3
   automated match to d2hx0a1
   complexed with mg

Details for d2hx0a2

PDB Entry: 2hx0, 1.55 Å

PDB Description: three-dimensional structure of the hypothetical protein from salmonella cholerae-suis (aka salmonella enterica) at the resolution 1.55 a. northeast structural genomics target scr59.

PDB Compounds: (A:) Putative DNA-binding protein

SCOPe Domain Sequences for d2hx0a2:

Sequence; same for both SEQRES and ATOM records:

>d2hx0a2 d.290.1.3 (A:5-141) automated matches {Salmonella enterica [TaxId: 28901]}
hhnastarfyalrllpgqevfsqlhafvqqnqlraawiagctgsltdvalryagqeatts
ltgtfevislngtleltgehlhlavsdpygvmlgghmmpgctvrttlelvigelpaltfs
rqpcaisgydelhissr

Timeline for d2hx0a2:

• d2hx0a2 first appeared in SCOP 1.73, called d2hx0a1
  
• d2hx0a2 appears in SCOPe 2.07