SCOPe 2.05: Domain d2hwnb_: 2hwn B:

Lineage for d2hwnb_ (2hwn B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)

6. Protein automated matches [190321] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187139] (1 PDB entry)

8. Domain d2hwnb_: 2hwn B: [136827]
   automated match to d1l6ea_
   complexed with gol

Details for d2hwnb_

PDB Entry: 2hwn, 1.6 Å

PDB Description: Crystal Structure of RII alpha Dimerization/Docking domain of PKA bound to the D-AKAP2 peptide

PDB Compounds: (B:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOPe Domain Sequences for d2hwnb_:

Sequence; same for both SEQRES and ATOM records:

>d2hwnb_ a.31.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mshiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr

Timeline for d2hwnb_:

• d2hwnb_ first appeared in SCOP 1.73, called d2hwnb1
  
• d2hwnb_ appears in SCOPe 2.04
  
• d2hwnb_ appears in SCOPe 2.06
  
• d2hwnb_ appears in the current release, SCOPe 2.08