Lineage for d2hwnb1 (2hwn B:5-43)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640145Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 640146Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family) (S)
    dimer of identical alpha-hairpin motifs
  5. 640147Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (2 proteins)
  6. 640152Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species)
  7. 640153Species Mouse (Mus musculus) [TaxId:10090] [47394] (6 PDB entries)
  8. 640155Domain d2hwnb1: 2hwn B:5-43 [136827]
    automatically matched to d1l6ea_
    complexed with gol

Details for d2hwnb1

PDB Entry: 2hwn (more details), 1.6 Å

PDB Description: Crystal Structure of RII alpha Dimerization/Docking domain of PKA bound to the D-AKAP2 peptide
PDB Compounds: (B:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOP Domain Sequences for d2hwnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hwnb1 a.31.1.1 (B:5-43) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
ippgltellqgytvevlrqqppdlvdfaveyftrlrear

SCOP Domain Coordinates for d2hwnb1:

Click to download the PDB-style file with coordinates for d2hwnb1.
(The format of our PDB-style files is described here.)

Timeline for d2hwnb1: