SCOP 1.73: Domain d2hwna1: 2hwn A:5-43

Lineage for d2hwna1 (2hwn A:5-43)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (2 proteins)

6. Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47394] (6 PDB entries)

8. Domain d2hwna1: 2hwn A:5-43 [136826]
   automatically matched to d1l6ea_
   complexed with gol

Details for d2hwna1

PDB Entry: 2hwn, 1.6 Å

PDB Description: Crystal Structure of RII alpha Dimerization/Docking domain of PKA bound to the D-AKAP2 peptide

PDB Compounds: (A:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOP Domain Sequences for d2hwna1:

Sequence; same for both SEQRES and ATOM records:

>d2hwna1 a.31.1.1 (A:5-43) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
ippgltellqgytvevlrqqppdlvdfaveyftrlrear

Timeline for d2hwna1:

• d2hwna1 is new in SCOP 1.73
  
• d2hwna1 appears in SCOP 1.75
  
• d2hwna1 appears in the current release, SCOPe 2.08, called d2hwna_