| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily) 4 helices; bundle, closed, right-handed twist |
Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) ![]() dimer of identical alpha-hairpin motifs |
| Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins) |
| Protein automated matches [190321] (3 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [187139] (1 PDB entry) |
| Domain d2hwna_: 2hwn A: [136826] automated match to d1l6ea_ complexed with gol |
PDB Entry: 2hwn (more details), 1.6 Å
SCOPe Domain Sequences for d2hwna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hwna_ a.31.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ippgltellqgytvevlrqqppdlvdfaveyftrlrear
Timeline for d2hwna_: