Lineage for d2hwna_ (2hwn A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709186Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 2709187Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) (S)
    dimer of identical alpha-hairpin motifs
  5. 2709188Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)
  6. 2709206Protein automated matches [190321] (3 species)
    not a true protein
  7. 2709233Species Norway rat (Rattus norvegicus) [TaxId:10116] [187139] (1 PDB entry)
  8. 2709234Domain d2hwna_: 2hwn A: [136826]
    automated match to d1l6ea_
    complexed with gol

Details for d2hwna_

PDB Entry: 2hwn (more details), 1.6 Å

PDB Description: Crystal Structure of RII alpha Dimerization/Docking domain of PKA bound to the D-AKAP2 peptide
PDB Compounds: (A:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOPe Domain Sequences for d2hwna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hwna_ a.31.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ippgltellqgytvevlrqqppdlvdfaveyftrlrear

SCOPe Domain Coordinates for d2hwna_:

Click to download the PDB-style file with coordinates for d2hwna_.
(The format of our PDB-style files is described here.)

Timeline for d2hwna_: