Lineage for d2hw4a1 (2hw4 A:5-122)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010920Fold d.322: PHP14-like [143723] (1 superfamily)
    beta(3)-alpha-beta(2)-alpha-beta; 3 layers, a/b/a; mixed beta-sheet, half-barrel, order: 132456; strands 2 and 5 are antiparallel to the rest
  4. 3010921Superfamily d.322.1: PHP14-like [143724] (2 families) (S)
  5. 3010922Family d.322.1.1: Janus/Ocnus [143725] (1 protein)
    Pfam PF05005
  6. 3010923Protein Phosphohistidine phosphatase 1, PHP14 [143726] (1 species)
    Janus-A homolog
  7. 3010924Species Human (Homo sapiens) [TaxId:9606] [143727] (5 PDB entries)
    Uniprot Q9NRX4 1-125! Uniprot Q9NRX4 2-121! Uniprot Q9NRX4 5-122
  8. 3010925Domain d2hw4a1: 2hw4 A:5-122 [136821]
    Other proteins in same PDB: d2hw4a2
    complexed with fmt

Details for d2hw4a1

PDB Entry: 2hw4 (more details), 1.9 Å

PDB Description: Crystal structure of human phosphohistidine phosphatase
PDB Compounds: (A:) 14 kDa phosphohistidine phosphatase

SCOPe Domain Sequences for d2hw4a1:

Sequence, based on SEQRES records: (download)

>d2hw4a1 d.322.1.1 (A:5-122) Phosphohistidine phosphatase 1, PHP14 {Human (Homo sapiens) [TaxId: 9606]}
dlalipdvdidsdgvfkyvlirvhsaprsgapaaeskeivrgykwaeyhadiydkvsgdm
qkqgcdceclgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtwan

Sequence, based on observed residues (ATOM records): (download)

>d2hw4a1 d.322.1.1 (A:5-122) Phosphohistidine phosphatase 1, PHP14 {Human (Homo sapiens) [TaxId: 9606]}
dlalipdvdidsdgvfkyvlirvhsaeskeivrgykwaeyhadiydkvsgdmqkqgcdce
clgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtwan

SCOPe Domain Coordinates for d2hw4a1:

Click to download the PDB-style file with coordinates for d2hw4a1.
(The format of our PDB-style files is described here.)

Timeline for d2hw4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hw4a2