Lineage for d2hw3a1 (2hw3 A:297-468)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495032Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2495033Protein automated matches [190396] (40 species)
    not a true protein
  7. 2495097Species Geobacillus stearothermophilus [TaxId:1422] [255224] (2 PDB entries)
  8. 2495098Domain d2hw3a1: 2hw3 A:297-468 [136819]
    Other proteins in same PDB: d2hw3a2
    automated match to d4dqqd1
    protein/DNA complex; complexed with mg, so4, suc

Details for d2hw3a1

PDB Entry: 2hw3 (more details), 1.98 Å

PDB Description: t:o6-methyl-guanine pair in the polymerase postinsertion site (-1 basepair position)
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d2hw3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hw3a1 c.55.3.0 (A:297-468) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
kkmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOPe Domain Coordinates for d2hw3a1:

Click to download the PDB-style file with coordinates for d2hw3a1.
(The format of our PDB-style files is described here.)

Timeline for d2hw3a1: