Lineage for d2hvya2 (2hvy A:11-252)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615008Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 2615009Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 2615024Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
    contains C-terminal PUA domain
  6. 2615025Protein Pseudouridine synthase II TruB [69747] (5 species)
  7. 2615037Species Pyrococcus furiosus [TaxId:2261] [143434] (2 PDB entries)
    Uniprot Q7LWY0 5-249
  8. 2615038Domain d2hvya2: 2hvy A:11-252 [136818]
    Other proteins in same PDB: d2hvya1, d2hvyb1, d2hvyc1, d2hvyd1
    automatically matched to 2EY4 A:8-252
    protein/RNA complex; complexed with atp, zn

Details for d2hvya2

PDB Entry: 2hvy (more details), 2.3 Å

PDB Description: crystal structure of an h/aca box rnp from pyrococcus furiosus
PDB Compounds: (A:) Probable tRNA pseudouridine synthase B

SCOPe Domain Sequences for d2hvya2:

Sequence, based on SEQRES records: (download)

>d2hvya2 d.265.1.2 (A:11-252) Pseudouridine synthase II TruB {Pyrococcus furiosus [TaxId: 2261]}
rilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevvawik
kilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedkiiq
vmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirslihhi
glalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpmekav
eh

Sequence, based on observed residues (ATOM records): (download)

>d2hvya2 d.265.1.2 (A:11-252) Pseudouridine synthase II TruB {Pyrococcus furiosus [TaxId: 2261]}
rilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevvawik
kilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedkiiq
vmkefegeiiqrppllrtrkvyyievleiegrdvlfrvgveagtyirslihhiglalgvg
ahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpmekaveh

SCOPe Domain Coordinates for d2hvya2:

Click to download the PDB-style file with coordinates for d2hvya2.
(The format of our PDB-style files is described here.)

Timeline for d2hvya2: