SCOPe 2.07: Domain d2hvya1: 2hvy A:253-336

Lineage for d2hvya1 (2hvy A:253-336)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.1: PUA domain [88698] (6 proteins)
   RNA-binding domain

6. Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)

7. Species Pyrococcus furiosus [TaxId:2261] [141699] (2 PDB entries)
   Uniprot Q7LWY0 250-333

8. Domain d2hvya1: 2hvy A:253-336 [136817]
   Other proteins in same PDB: d2hvya2, d2hvyb1, d2hvyc1, d2hvyd1
   automatically matched to 2EY4 A:253-336
   protein/RNA complex; complexed with atp, zn

Details for d2hvya1

PDB Entry: 2hvy, 2.3 Å

PDB Description: crystal structure of an h/aca box rnp from pyrococcus furiosus

PDB Compounds: (A:) Probable tRNA pseudouridine synthase B

SCOPe Domain Sequences for d2hvya1:

Sequence; same for both SEQRES and ATOM records:

>d2hvya1 b.122.1.1 (A:253-336) Pseudouridine synthase II TruB, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
lpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsqem
lektkgiavdvekvfmprdwypkl

Timeline for d2hvya1:

• d2hvya1 first appeared in SCOP 1.73
  
• d2hvya1 appears in SCOPe 2.06
  
• d2hvya1 appears in the current release, SCOPe 2.08