SCOPe 2.08: Domain d2hvkc_: 2hvk C:

Lineage for d2hvkc_ (2hvk C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (3 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (36 PDB entries)

8. Domain d2hvkc_: 2hvk C: [136813]
   Other proteins in same PDB: d2hvka1, d2hvka2, d2hvka3, d2hvkb1, d2hvkb2
   automated match to d1r3jc_
   complexed with f09, k, l2c, tba

Details for d2hvkc_

PDB Entry: 2hvk, 1.9 Å

PDB Description: crystal structure of the kcsa-fab-tba complex in high k+

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2hvkc_:

Sequence; same for both SEQRES and ATOM records:

>d2hvkc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d2hvkc_:

• d2hvkc_ first appeared in SCOP 1.73, called d2hvkc1
  
• d2hvkc_ appears in SCOPe 2.07