Lineage for d2hvid2 (2hvi D:469-876)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743030Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 743031Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 743032Family e.8.1.1: DNA polymerase I [56673] (4 proteins)
  6. 743033Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 743034Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (42 PDB entries)
  8. 743058Domain d2hvid2: 2hvi D:469-876 [136811]
    Other proteins in same PDB: d2hvia1, d2hvid1
    automatically matched to d1l3sa2
    complexed with dct, ddg, mg, so4, suc

Details for d2hvid2

PDB Entry: 2hvi (more details), 1.98 Å

PDB Description: ddctp:g pair in the polymerase active site (0 position)
PDB Compounds: (D:) DNA polymerase I

SCOP Domain Sequences for d2hvid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hvid2 e.8.1.1 (D:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpatkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nygivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOP Domain Coordinates for d2hvid2:

Click to download the PDB-style file with coordinates for d2hvid2.
(The format of our PDB-style files is described here.)

Timeline for d2hvid2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hvid1