Lineage for d2hvdb1 (2hvd B:4-152)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724206Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (3 PDB entries)
  8. 724217Domain d2hvdb1: 2hvd B:4-152 [136802]
    automatically matched to d1jxva_
    complexed with adp

Details for d2hvdb1

PDB Entry: 2hvd (more details), 2.15 Å

PDB Description: human nucleoside diphosphate kinase a complexed with adp
PDB Compounds: (B:) Nucleoside Diphosphate Kinase A

SCOP Domain Sequences for d2hvdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hvdb1 d.58.6.1 (B:4-152) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
esaekeiglwfhpeelvdytscaqnwiye

SCOP Domain Coordinates for d2hvdb1:

Click to download the PDB-style file with coordinates for d2hvdb1.
(The format of our PDB-style files is described here.)

Timeline for d2hvdb1: