Lineage for d2hvaa1 (2hva A:1-190)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726268Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
    duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)
  4. 726269Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (4 families) (S)
  5. 726289Family d.60.1.4: SOUL heme-binding protein [143481] (1 protein)
    Pfam PF04832
  6. 726290Protein Heme-binding protein 1 [143482] (1 species)
    p22HBP
  7. 726291Species Mouse (Mus musculus) [TaxId:10090] [143483] (2 PDB entries)
  8. 726292Domain d2hvaa1: 2hva A:1-190 [136800]

Details for d2hvaa1

PDB Entry: 2hva (more details)

PDB Description: solution structure of the haem-binding protein p22hbp
PDB Compounds: (A:) Heme-binding protein 1

SCOP Domain Sequences for d2hvaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hvaa1 d.60.1.4 (A:1-190) Heme-binding protein 1 {Mouse (Mus musculus) [TaxId: 10090]}
mlgmirnslfgsvetwpwqvlstggkedvsyeeraceggkfatvevtdkpvdealreamp
kimkyvggtndkgvgmgmtvpvsfavfpnedgslqkklkvwfripnqfqgsppapsdesv
kieeregitvystqfggyakeadyvahatqlrttlegtpatyqgdvyycagydppmkpyg
rrnevwlvka

SCOP Domain Coordinates for d2hvaa1:

Click to download the PDB-style file with coordinates for d2hvaa1.
(The format of our PDB-style files is described here.)

Timeline for d2hvaa1: