Lineage for d2hvaa1 (2hva A:1-190)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
    duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)
  4. Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) (S)
  5. Family d.60.1.4: SOUL heme-binding protein [143481] (2 proteins)
    Pfam PF04832
  6. Protein Heme-binding protein 1 [143482] (1 species)
    p22HBP
  7. Species Mouse (Mus musculus) [TaxId:10090] [143483] (3 PDB entries)
    Uniprot Q9R257 1-190! Uniprot Q9R257 7-190
  8. Domain d2hvaa1: 2hva A:1-190 [136800]

Details for d2hvaa1

PDB Entry: 2hva (more details)

PDB Description: Solution Structure of the haem-binding protein p22HBP
PDB Compounds: (A:) Heme-binding protein 1

SCOPe Domain Sequences for d2hvaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hvaa1 d.60.1.4 (A:1-190) Heme-binding protein 1 {Mouse (Mus musculus) [TaxId: 10090]}
mlgmirnslfgsvetwpwqvlstggkedvsyeeraceggkfatvevtdkpvdealreamp
kimkyvggtndkgvgmgmtvpvsfavfpnedgslqkklkvwfripnqfqgsppapsdesv
kieeregitvystqfggyakeadyvahatqlrttlegtpatyqgdvyycagydppmkpyg
rrnevwlvka

SCOPe Domain Coordinates for d2hvaa1 are not available.

Timeline for d2hvaa1: