Lineage for d2hv9a_ (2hv9 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130188Family c.66.1.34: mRNA cap (Guanine N-7) methyltransferase [102560] (1 protein)
    mRNA capping enzyme
    automatically mapped to Pfam PF03291
  6. 2130189Protein mRNA cap (Guanine N-7) methyltransferase [102561] (1 species)
  7. 2130190Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [102562] (7 PDB entries)
  8. 2130195Domain d2hv9a_: 2hv9 A: [136799]
    automated match to d1ri5a_
    protein/RNA complex; complexed with sfg

Details for d2hv9a_

PDB Entry: 2hv9 (more details), 2.6 Å

PDB Description: Encephalitozoon cuniculi mRNA Cap (Guanine-N7) Methyltransferase in complex with sinefungin
PDB Compounds: (A:) mRNA cap guanine-N7 methyltransferase

SCOPe Domain Sequences for d2hv9a_:

Sequence, based on SEQRES records: (download)

>d2hv9a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
sktinirnannfikaclirlytkrgdsvldlgcgkggdllkyeragigeyygvdiaevsi
ndarvrarnmkrrfkvffraqdsygrhmdlgkefdvissqfsfhyafstsesldiaqrni
arhlrpggyfimtvpsrdvilerykqgrmsndfykielekmedvpmesvreyrftlldsv
nncieyfvdftrmvdgfkrlglslverkgfidfyedegrrnpelskkmglgcltreesev
vgiyevvvfrkl

Sequence, based on observed residues (ATOM records): (download)

>d2hv9a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
sktinirnannfikaclirlytkrgdsvldlgcgkggdllkyeragigeyygvdiaevsi
ndarvrarnmkrrfkvffraqdsygrhmdlgkefdvissqfsfhyafstsesldiaqrni
arhlrpggyfimtvpsrdvilerykqgrmsndfykielekmvpmesvreyrftlldsvnn
cieyfvdftrmvdgfkrlglslverkgfidfyedegrrnpelskklgcltreesevvgiy
evvvfrkl

SCOPe Domain Coordinates for d2hv9a_:

Click to download the PDB-style file with coordinates for d2hv9a_.
(The format of our PDB-style files is described here.)

Timeline for d2hv9a_: