Lineage for d2hv8e1 (2hv8 E:703-756)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 752208Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 753199Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family) (S)
  5. 753200Family h.1.31.1: Eferin C-derminal domain-like [144271] (2 proteins)
    contains PfamB 042332, PfamB 026102
  6. 753206Protein Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) [144274] (1 species)
  7. 753207Species Human (Homo sapiens) [TaxId:9606] [144275] (2 PDB entries)
  8. 753211Domain d2hv8e1: 2hv8 E:703-756 [136798]
    Other proteins in same PDB: d2hv8a1, d2hv8b1, d2hv8c1
    automatically matched to 2HV8 D:703-756
    complexed with 2me, gtp, mes, mg, so4; mutant

Details for d2hv8e1

PDB Entry: 2hv8 (more details), 1.86 Å

PDB Description: Crystal structure of GTP-bound Rab11 in complex with FIP3
PDB Compounds: (E:) Rab11 family-interacting protein 3

SCOP Domain Sequences for d2hv8e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hv8e1 h.1.31.1 (E:703-756) Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) {Human (Homo sapiens) [TaxId: 9606]}
afseslaaeissvsrdelmeaiqkqeeinfrlqdyidriivaimetnpsilevk

SCOP Domain Coordinates for d2hv8e1:

Click to download the PDB-style file with coordinates for d2hv8e1.
(The format of our PDB-style files is described here.)

Timeline for d2hv8e1: