SCOPe 2.03: Domain d2hv8d1: 2hv8 D:703-756

Lineage for d2hv8d1 (2hv8 D:703-756)

1. Root: SCOPe 2.03

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family)

5. Family h.1.31.1: Eferin C-derminal domain-like [144271] (2 proteins)
   contains PfamB PB042332, PfamB PB026102

6. Protein Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) [144274] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144275] (2 PDB entries)
   Uniprot O75154 703-756! Uniprot O75154 715-756

8. Domain d2hv8d1: 2hv8 D:703-756 [136797]
   Other proteins in same PDB: d2hv8a_, d2hv8b_, d2hv8c_
   complexed with 2me, gtp, mes, mg, so4

Details for d2hv8d1

PDB Entry: 2hv8, 1.86 Å

PDB Description: crystal structure of gtp-bound rab11 in complex with fip3

PDB Compounds: (D:) Rab11 family-interacting protein 3

SCOPe Domain Sequences for d2hv8d1:

Sequence; same for both SEQRES and ATOM records:

>d2hv8d1 h.1.31.1 (D:703-756) Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) {Human (Homo sapiens) [TaxId: 9606]}
afseslaaeissvsrdelmeaiqkqeeinfrlqdyidriivaimetnpsilevk

Timeline for d2hv8d1:

• d2hv8d1 first appeared in SCOP 1.73
  
• d2hv8d1 appears in SCOPe 2.02
  
• d2hv8d1 appears in SCOPe 2.04
  
• d2hv8d1 appears in the current release, SCOPe 2.08