SCOPe 2.03: Domain d2hv8a_: 2hv8 A:

Lineage for d2hv8a_ (2hv8 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (113 PDB entries)

8. Domain d2hv8a_: 2hv8 A: [136794]
   Other proteins in same PDB: d2hv8d1, d2hv8e_, d2hv8f_
   automated match to d1oiva_
   complexed with 2me, gtp, mes, mg, so4

Details for d2hv8a_

PDB Entry: 2hv8, 1.86 Å

PDB Description: crystal structure of gtp-bound rab11 in complex with fip3

PDB Compounds: (A:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d2hv8a_:

Sequence; same for both SEQRES and ATOM records:

>d2hv8a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
tagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri

Timeline for d2hv8a_:

• d2hv8a_ first appeared in SCOP 1.73, called d2hv8a1
  
• d2hv8a_ appears in SCOPe 2.02
  
• d2hv8a_ appears in SCOPe 2.04
  
• d2hv8a_ appears in the current release, SCOPe 2.08