Lineage for d2hv7e_ (2hv7 E:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1509745Fold a.268: PTPA-like [140983] (1 superfamily)
    multihelical
  4. 1509746Superfamily a.268.1: PTPA-like [140984] (1 family) (S)
    automatically mapped to Pfam PF03095
  5. 1509747Family a.268.1.1: PTPA-like [140985] (2 proteins)
    Pfam PF03095
  6. 1509748Protein Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA [140986] (2 species)
  7. 1509753Species Human (Homo sapiens) [TaxId:9606] [140987] (4 PDB entries)
    Uniprot Q15257 22-322! Uniprot Q15257 23-322
  8. 1509762Domain d2hv7e_: 2hv7 E: [136790]
    automated match to d2hv6a1
    complexed with adp

Details for d2hv7e_

PDB Entry: 2hv7 (more details), 2.5 Å

PDB Description: Crystal structure of phosphotyrosyl phosphatase activator bound to ATPgammaS
PDB Compounds: (E:) Protein phosphatase 2A, regulatory subunit B

SCOPe Domain Sequences for d2hv7e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hv7e_ a.268.1.1 (E:) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Human (Homo sapiens) [TaxId: 9606]}
nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
s

SCOPe Domain Coordinates for d2hv7e_:

Click to download the PDB-style file with coordinates for d2hv7e_.
(The format of our PDB-style files is described here.)

Timeline for d2hv7e_: