Lineage for d2hv7c_ (2hv7 C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1754885Fold a.268: PTPA-like [140983] (1 superfamily)
    multihelical
  4. 1754886Superfamily a.268.1: PTPA-like [140984] (1 family) (S)
    automatically mapped to Pfam PF03095
  5. 1754887Family a.268.1.1: PTPA-like [140985] (2 proteins)
    Pfam PF03095
  6. 1754888Protein Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA [140986] (2 species)
  7. 1754893Species Human (Homo sapiens) [TaxId:9606] [140987] (4 PDB entries)
    Uniprot Q15257 22-322! Uniprot Q15257 23-322
  8. 1754900Domain d2hv7c_: 2hv7 C: [136788]
    automated match to d2hv6a1
    complexed with adp

Details for d2hv7c_

PDB Entry: 2hv7 (more details), 2.5 Å

PDB Description: Crystal structure of phosphotyrosyl phosphatase activator bound to ATPgammaS
PDB Compounds: (C:) Protein phosphatase 2A, regulatory subunit B

SCOPe Domain Sequences for d2hv7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hv7c_ a.268.1.1 (C:) Serine/threonine-protein phosphatase 2A regulatory subunit B', PTPA {Human (Homo sapiens) [TaxId: 9606]}
nfiipkkeihtvpdmgkwkrsqayadyigfiltlnegvkgkkltfeyrvseaieklvall
ntldrwidetppvdqpsrfgnkayrtwyakldeeaenlvatvvpthlaaavpevavylke
svgnstridygtgheaafaaflcclckigvlrvddqiaivfkvfnrylevmrklqktyrm
epagsqgvwglddfqflpfiwgssqlidhpyleprhfvdekavnenhkdymflecilfit
emktgpfaehsnqlwnisavpswskvnqglirmykaeclekfpviqhfkfgsllpihpvt
s

SCOPe Domain Coordinates for d2hv7c_:

Click to download the PDB-style file with coordinates for d2hv7c_.
(The format of our PDB-style files is described here.)

Timeline for d2hv7c_: