SCOPe 2.08: Domain d2huwb_: 2huw B:

Lineage for d2huwb_ (2huw B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55564] (38 PDB entries)

8. Domain d2huwb_: 2huw B: [136780]
   automated match to d1fhs__
   complexed with po4, yvn

Details for d2huwb_

PDB Entry: 2huw, 1.9 Å

PDB Description: x-ray crystal structure of the grb2 sh2 domain complexed to a constrained and cyclopropane-derived ligand

PDB Compounds: (B:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d2huwb_:

Sequence; same for both SEQRES and ATOM records:

>d2huwb_ d.93.1.1 (B:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
kphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieq

Timeline for d2huwb_:

• d2huwb_ first appeared in SCOP 1.73, called d2huwb1
  
• d2huwb_ appears in SCOPe 2.07