Lineage for d2huoa1 (2huo A:28-285)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737142Family a.211.1.4: MioX-like [140769] (1 protein)
    Pfam PF05153; DUF706
  6. 2737143Protein Myo-inositol oxygenase MioX [140770] (2 species)
  7. 2737147Species Mouse (Mus musculus) [TaxId:10090] [140772] (2 PDB entries)
    Uniprot Q9QXN5 28-285
  8. 2737148Domain d2huoa1: 2huo A:28-285 [136778]
    complexed with fe, fmt, ins, oh

Details for d2huoa1

PDB Entry: 2huo (more details), 2 Å

PDB Description: Crystal structure of mouse myo-inositol oxygenase in complex with substrate
PDB Compounds: (A:) Inositol oxygenase

SCOPe Domain Sequences for d2huoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2huoa1 a.211.1.4 (A:28-285) Myo-inositol oxygenase MioX {Mouse (Mus musculus) [TaxId: 10090]}
frnytsgplldrvfttyklmhthqtvdfvsrkriqygsfsykkmtimeavgmlddlvdes
dpdvdfpnsfhafqtaegirkahpdkdwfhlvgllhdlgkimalwgepqwavvgdtfpvg
crpqasvvfcdstfqdnpdlqdprystelgmyqphcglenvlmswghdeylyqmmkfnkf
slpseafymirfhsfypwhtggdyrqlcsqqdldmlpwvqefnkfdlytkcpdlpdvesl
rpyyqglidkycpgtlsw

SCOPe Domain Coordinates for d2huoa1:

Click to download the PDB-style file with coordinates for d2huoa1.
(The format of our PDB-style files is described here.)

Timeline for d2huoa1: