![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.26: YppE-like [140415] (1 family) ![]() flattened bundle at one end with helices 2 and coming in contact and separating helices 1 and 3 automatically mapped to Pfam PF08807 |
![]() | Family a.24.26.1: YppE-like [140416] (3 proteins) Pfam PF08807; DUF1798 |
![]() | Protein Hypothetical protein Lin2004 [140417] (1 species) |
![]() | Species Listeria innocua [TaxId:1642] [140418] (1 PDB entry) Uniprot Q92AB8 1-120 |
![]() | Domain d2huja1: 2huj A:1-120 [136777] Other proteins in same PDB: d2huja2 |
PDB Entry: 2huj (more details), 1.74 Å
SCOPe Domain Sequences for d2huja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2huja1 a.24.26.1 (A:1-120) Hypothetical protein Lin2004 {Listeria innocua [TaxId: 1642]} mellirteqlllqneknwelylsnreeekpfdfykdmkpfvdeakrcaddflelaipwvn terppylgelqlrqacdnvqmtavsafngrsfykhfldhyqstkytltrvrdflkrkees
Timeline for d2huja1: