Lineage for d2huja1 (2huj A:1-120)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1483413Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1484389Superfamily a.24.26: YppE-like [140415] (1 family) (S)
    flattened bundle at one end with helices 2 and coming in contact and separating helices 1 and 3
    automatically mapped to Pfam PF08807
  5. 1484390Family a.24.26.1: YppE-like [140416] (3 proteins)
    Pfam PF08807; DUF1798
  6. 1484391Protein Hypothetical protein Lin2004 [140417] (1 species)
  7. 1484392Species Listeria innocua [TaxId:1642] [140418] (1 PDB entry)
    Uniprot Q92AB8 1-120
  8. 1484393Domain d2huja1: 2huj A:1-120 [136777]

Details for d2huja1

PDB Entry: 2huj (more details), 1.74 Å

PDB Description: crystal structure of a protein of uknown function (np_471338.1) from listeria innocua at 1.74 a resolution
PDB Compounds: (A:) Lin2004 protein

SCOPe Domain Sequences for d2huja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2huja1 a.24.26.1 (A:1-120) Hypothetical protein Lin2004 {Listeria innocua [TaxId: 1642]}
mellirteqlllqneknwelylsnreeekpfdfykdmkpfvdeakrcaddflelaipwvn
terppylgelqlrqacdnvqmtavsafngrsfykhfldhyqstkytltrvrdflkrkees

SCOPe Domain Coordinates for d2huja1:

Click to download the PDB-style file with coordinates for d2huja1.
(The format of our PDB-style files is described here.)

Timeline for d2huja1: