SCOP 1.73: Domain d2huja1: 2huj A:1-120

Lineage for d2huja1 (2huj A:1-120)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.26: YppE-like [140415] (1 family)
   flattened bundle at one end with helices 2 and coming in contact and separating helices 1 and 3

5. Family a.24.26.1: YppE-like [140416] (3 proteins)
   Pfam PF08807; DUF1798

6. Protein Hypothetical protein Lin2004 [140417] (1 species)

7. Species Listeria innocua [TaxId:1642] [140418] (1 PDB entry)

8. Domain d2huja1: 2huj A:1-120 [136777]

Details for d2huja1

PDB Entry: 2huj, 1.74 Å

PDB Description: crystal structure of a protein of uknown function (np_471338.1) from listeria innocua at 1.74 a resolution

PDB Compounds: (A:) Lin2004 protein

SCOP Domain Sequences for d2huja1:

Sequence; same for both SEQRES and ATOM records:

>d2huja1 a.24.26.1 (A:1-120) Hypothetical protein Lin2004 {Listeria innocua [TaxId: 1642]}
mellirteqlllqneknwelylsnreeekpfdfykdmkpfvdeakrcaddflelaipwvn
terppylgelqlrqacdnvqmtavsafngrsfykhfldhyqstkytltrvrdflkrkees

Timeline for d2huja1:

• d2huja1 is new in SCOP 1.73
  
• d2huja1 appears in SCOP 1.75
  
• d2huja1 appears in the current release, SCOPe 2.08