![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein automated matches [190203] (5 species) not a true protein |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [187086] (10 PDB entries) |
![]() | Domain d2huec_: 2hue C: [136776] Other proteins in same PDB: d2huea1 automated match to d1aoif_ complexed with gol, so4, zn |
PDB Entry: 2hue (more details), 1.7 Å
SCOPe Domain Sequences for d2huec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2huec_ a.22.1.1 (C:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk tvtamdvvyalkrqgrtlygfg
Timeline for d2huec_: