SCOP 1.73: Domain d2hu8b2: 2hu8 B:322-581

Lineage for d2hu8b2 (2hu8 B:322-581)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.33: Acylamino-acid-releasing enzyme, C-terminal donain [117711] (1 protein)
   closely related to the prolyl peptidase and DPP6 domains (scop_fa 53496 and 82497)

6. Protein Acylamino-acid-releasing enzyme, C-terminal donain [117712] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [117713] (5 PDB entries)

8. Domain d2hu8b2: 2hu8 B:322-581 [136775]
   Other proteins in same PDB: d2hu8a1, d2hu8b1
   automatically matched to d1ve6a2
   complexed with be2, gly, phe; mutant

Details for d2hu8b2

PDB Entry: 2hu8, 2.4 Å

PDB Description: binding of inhibitors by acylaminoacyl peptidase

PDB Compounds: (B:) Acylamino-acid-releasing enzyme

SCOP Domain Sequences for d2hu8b2:

Sequence; same for both SEQRES and ATOM records:

>d2hu8b2 c.69.1.33 (B:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}
lpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhggpfaedsdswdtf
aaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaarwaresglaselyi
mgyayggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnfieqltggsreimr
srspinhvdrikeplalihpqndsrtplkpllrlmgellargktfeahiipdaghaintm
edavkillpavfflatqrer

Timeline for d2hu8b2:

• d2hu8b2 is new in SCOP 1.73
  
• d2hu8b2 appears in SCOP 1.75
  
• d2hu8b2 appears in the current release, SCOPe 2.08