Lineage for d2hu8b1 (2hu8 B:9-321)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675262Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 675454Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (2 families) (S)
  5. 675474Family b.69.7.2: Acylamino-acid-releasing enzyme, N-terminal donain [117286] (1 protein)
  6. 675475Protein Acylamino-acid-releasing enzyme, N-terminal donain [117287] (1 species)
  7. 675476Species Aeropyrum pernix [TaxId:56636] [117288] (5 PDB entries)
  8. 675484Domain d2hu8b1: 2hu8 B:9-321 [136774]
    Other proteins in same PDB: d2hu8a2, d2hu8b2
    automatically matched to d1ve6a1
    complexed with be2, gly, phe; mutant

Details for d2hu8b1

PDB Entry: 2hu8 (more details), 2.4 Å

PDB Description: binding of inhibitors by acylaminoacyl peptidase
PDB Compounds: (B:) Acylamino-acid-releasing enzyme

SCOP Domain Sequences for d2hu8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hu8b1 b.69.7.2 (B:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]}
fsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsvl
dphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvftg
atedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssgglr
vfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrptai
twlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppri
vslpsgepllegg

SCOP Domain Coordinates for d2hu8b1:

Click to download the PDB-style file with coordinates for d2hu8b1.
(The format of our PDB-style files is described here.)

Timeline for d2hu8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hu8b2