SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2hu8a2 (2hu8 A:322-581)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135955Family c.69.1.33: Acylamino-acid-releasing enzyme, C-terminal donain [117711] (1 protein)
    closely related to the prolyl peptidase and DPP6 domains ((53496) and 82497)
    automatically mapped to Pfam PF12697
  6. 2135956Protein Acylamino-acid-releasing enzyme, C-terminal donain [117712] (1 species)
  7. 2135957Species Aeropyrum pernix [TaxId:56636] [117713] (10 PDB entries)
    Uniprot Q9YBQ2
  8. 2135968Domain d2hu8a2: 2hu8 A:322-581 [136773]
    Other proteins in same PDB: d2hu8a1, d2hu8b1
    automatically matched to d1ve6a2
    complexed with be2

Details for d2hu8a2

PDB Entry: 2hu8 (more details), 2.4 Å

PDB Description: Binding of inhibitors by Acylaminoacyl peptidase
PDB Compounds: (A:) Acylamino-acid-releasing enzyme

SCOPe Domain Sequences for d2hu8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hu8a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}
lpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhggpfaedsdswdtf
aaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaarwaresglaselyi
mgyayggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnfieqltggsreimr
srspinhvdrikeplalihpqndsrtplkpllrlmgellargktfeahiipdaghaintm
edavkillpavfflatqrer

SCOPe Domain Coordinates for d2hu8a2:

Click to download the PDB-style file with coordinates for d2hu8a2.
(The format of our PDB-style files is described here.)

Timeline for d2hu8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hu8a1