Lineage for d2hu7b2 (2hu7 B:322-581)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 706658Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 706659Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 707667Family c.69.1.33: Acylamino-acid-releasing enzyme, C-terminal donain [117711] (1 protein)
    closely related to the prolyl peptidase and DPP6 domains (scop_fa 53496 and 82497)
  6. 707668Protein Acylamino-acid-releasing enzyme, C-terminal donain [117712] (1 species)
  7. 707669Species Aeropyrum pernix [TaxId:56636] [117713] (5 PDB entries)
  8. 707671Domain d2hu7b2: 2hu7 B:322-581 [136771]
    Other proteins in same PDB: d2hu7a1, d2hu7b1
    automatically matched to d1ve6a2
    complexed with ace, gol, phe

Details for d2hu7b2

PDB Entry: 2hu7 (more details), 2.01 Å

PDB Description: Binding of inhibitors by Acylaminoacyl peptidase
PDB Compounds: (B:) Acylamino-acid-releasing enzyme

SCOP Domain Sequences for d2hu7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hu7b2 c.69.1.33 (B:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}
lpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhggpfaedsdswdtf
aaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaarwaresglaselyi
mgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnfieqltggsreimr
srspinhvdrikeplalihpqndsrtplkpllrlmgellargktfeahiipdaghaintm
edavkillpavfflatqrer

SCOP Domain Coordinates for d2hu7b2:

Click to download the PDB-style file with coordinates for d2hu7b2.
(The format of our PDB-style files is described here.)

Timeline for d2hu7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hu7b1