Lineage for d2hu7b1 (2hu7 B:9-321)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418888Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2418929Family b.69.7.2: Acylamino-acid-releasing enzyme, N-terminal donain [117286] (1 protein)
  6. 2418930Protein Acylamino-acid-releasing enzyme, N-terminal donain [117287] (1 species)
  7. 2418931Species Aeropyrum pernix [TaxId:56636] [117288] (10 PDB entries)
    Uniprot Q9YBQ2
  8. 2418933Domain d2hu7b1: 2hu7 B:9-321 [136770]
    Other proteins in same PDB: d2hu7a2, d2hu7b2
    automated match to d1ve6a1
    complexed with ace, gol, phe

Details for d2hu7b1

PDB Entry: 2hu7 (more details), 2.01 Å

PDB Description: Binding of inhibitors by Acylaminoacyl peptidase
PDB Compounds: (B:) Acylamino-acid-releasing enzyme

SCOPe Domain Sequences for d2hu7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hu7b1 b.69.7.2 (B:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]}
fsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsvl
dphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvftg
atedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssgglr
vfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrptai
twlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppri
vslpsgepllegg

SCOPe Domain Coordinates for d2hu7b1:

Click to download the PDB-style file with coordinates for d2hu7b1.
(The format of our PDB-style files is described here.)

Timeline for d2hu7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hu7b2