Lineage for d2hu6a1 (2hu6 A:106-263)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729341Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 729421Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 729422Species Human (Homo sapiens) [TaxId:9606] [69781] (15 PDB entries)
  8. 729427Domain d2hu6a1: 2hu6 A:106-263 [136767]
    automatically matched to d1os2a_
    complexed with 37a, ca, hae, zn; mutant

Details for d2hu6a1

PDB Entry: 2hu6 (more details), 1.32 Å

PDB Description: crystal structure of human mmp-12 in complex with acetohydroxamic acid and a bicyclic inhibitor
PDB Compounds: (A:) Macrophage metalloelastase

SCOP Domain Sequences for d2hu6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hu6a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOP Domain Coordinates for d2hu6a1:

Click to download the PDB-style file with coordinates for d2hu6a1.
(The format of our PDB-style files is described here.)

Timeline for d2hu6a1: