Class b: All beta proteins [48724] (174 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (2 families) |
Family b.69.7.2: Acylamino-acid-releasing enzyme, N-terminal donain [117286] (1 protein) |
Protein Acylamino-acid-releasing enzyme, N-terminal donain [117287] (1 species) |
Species Aeropyrum pernix [TaxId:56636] [117288] (7 PDB entries) Uniprot Q9YBQ2 |
Domain d2hu5b1: 2hu5 B:9-321 [136765] Other proteins in same PDB: d2hu5a2, d2hu5b2 automatically matched to d1ve6a1 complexed with gly, gol, phe |
PDB Entry: 2hu5 (more details), 2 Å
SCOP Domain Sequences for d2hu5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hu5b1 b.69.7.2 (B:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} fsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsvl dphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvftg atedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssgglr vfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrptai twlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppri vslpsgepllegg
Timeline for d2hu5b1: