Lineage for d2hu5b1 (2hu5 B:8-321)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2809416Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2809457Family b.69.7.2: Acylamino-acid-releasing enzyme, N-terminal donain [117286] (1 protein)
  6. 2809458Protein Acylamino-acid-releasing enzyme, N-terminal donain [117287] (1 species)
  7. 2809459Species Aeropyrum pernix [TaxId:56636] [117288] (10 PDB entries)
    Uniprot Q9YBQ2
  8. 2809463Domain d2hu5b1: 2hu5 B:8-321 [136765]
    Other proteins in same PDB: d2hu5a2, d2hu5b2
    automated match to d1ve6a1
    complexed with gly, gol, phe

Details for d2hu5b1

PDB Entry: 2hu5 (more details), 2 Å

PDB Description: Binding of inhibitors by Acylaminoacyl-peptidase
PDB Compounds: (B:) Acylamino-acid-releasing enzyme

SCOPe Domain Sequences for d2hu5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hu5b1 b.69.7.2 (B:8-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]}
efsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsv
ldphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvft
gatedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssggl
rvfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrpta
itwlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppr
ivslpsgepllegg

SCOPe Domain Coordinates for d2hu5b1:

Click to download the PDB-style file with coordinates for d2hu5b1.
(The format of our PDB-style files is described here.)

Timeline for d2hu5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hu5b2