Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.33: Acylamino-acid-releasing enzyme, C-terminal donain [117711] (1 protein) closely related to the prolyl peptidase and DPP6 domains ((53496) and 82497) automatically mapped to Pfam PF12697 |
Protein Acylamino-acid-releasing enzyme, C-terminal donain [117712] (1 species) |
Species Aeropyrum pernix [TaxId:56636] [117713] (10 PDB entries) Uniprot Q9YBQ2 |
Domain d2hu5a2: 2hu5 A:322-581 [136764] Other proteins in same PDB: d2hu5a1, d2hu5b1 automated match to d1ve6a2 complexed with gly, gol, phe |
PDB Entry: 2hu5 (more details), 2 Å
SCOPe Domain Sequences for d2hu5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hu5a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} lpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhggpfaedsdswdtf aaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaarwaresglaselyi mgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnfieqltggsreimr srspinhvdrikeplalihpqndsrtplkpllrlmgellargktfeahiipdaghaintm edavkillpavfflatqrer
Timeline for d2hu5a2: