Lineage for d2htia1 (2hti A:10-165)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2063731Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2063732Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2063733Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2063779Protein Hypothetical protein BH0577 [141348] (1 species)
  7. 2063780Species Bacillus halodurans [TaxId:86665] [141349] (1 PDB entry)
    Uniprot Q9KFA8 10-165
  8. 2063781Domain d2htia1: 2hti A:10-165 [136744]
    complexed with fad, na

Details for d2htia1

PDB Entry: 2hti (more details), 2.5 Å

PDB Description: crystal structure of a flavin-nucleotide-binding protein (bh_0577) from bacillus halodurans at 2.50 a resolution
PDB Compounds: (A:) BH0577 protein

SCOPe Domain Sequences for d2htia1:

Sequence, based on SEQRES records: (download)

>d2htia1 b.45.1.1 (A:10-165) Hypothetical protein BH0577 {Bacillus halodurans [TaxId: 86665]}
eckdekkiteflnkartgflglstndqpyviplnfvwhnhaiyfhgasegrkikmieanp
evcfticedlgtivspvpahtdtaymsviifgtiepvsaieegteamqqmldkyvpgyyh
splaashvekyrsslgsrtaiykiscrertakvnep

Sequence, based on observed residues (ATOM records): (download)

>d2htia1 b.45.1.1 (A:10-165) Hypothetical protein BH0577 {Bacillus halodurans [TaxId: 86665]}
eckdekkiteflnkartgflglstndqpyviplnfvwhnhaiyfhgasegrkikmieanp
evcfticedlaymsviifgtiepvsaieegteamqqmldkyvpslgsrtaiykiscrert
akvnep

SCOPe Domain Coordinates for d2htia1:

Click to download the PDB-style file with coordinates for d2htia1.
(The format of our PDB-style files is described here.)

Timeline for d2htia1: