![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein Hypothetical protein BH0577 [141348] (1 species) |
![]() | Species Bacillus halodurans [TaxId:86665] [141349] (1 PDB entry) Uniprot Q9KFA8 10-165 |
![]() | Domain d2htia1: 2hti A:10-165 [136744] complexed with fad, na |
PDB Entry: 2hti (more details), 2.5 Å
SCOPe Domain Sequences for d2htia1:
Sequence, based on SEQRES records: (download)
>d2htia1 b.45.1.1 (A:10-165) Hypothetical protein BH0577 {Bacillus halodurans [TaxId: 86665]} eckdekkiteflnkartgflglstndqpyviplnfvwhnhaiyfhgasegrkikmieanp evcfticedlgtivspvpahtdtaymsviifgtiepvsaieegteamqqmldkyvpgyyh splaashvekyrsslgsrtaiykiscrertakvnep
>d2htia1 b.45.1.1 (A:10-165) Hypothetical protein BH0577 {Bacillus halodurans [TaxId: 86665]} eckdekkiteflnkartgflglstndqpyviplnfvwhnhaiyfhgasegrkikmieanp evcfticedlaymsviifgtiepvsaieegteamqqmldkyvpslgsrtaiykiscrert akvnep
Timeline for d2htia1: