SCOP 1.73: Domain d2htia1: 2hti A:10-165

Lineage for d2htia1 (2hti A:10-165)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.45: Split barrel-like [50474] (2 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (3 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)

6. Protein Hypothetical protein BH0577 [141348] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [141349] (1 PDB entry)

8. Domain d2htia1: 2hti A:10-165 [136744]
   complexed with fad, na

Details for d2htia1

PDB Entry: 2hti, 2.5 Å

PDB Description: crystal structure of a flavin-nucleotide-binding protein (bh_0577) from bacillus halodurans at 2.50 a resolution

PDB Compounds: (A:) BH0577 protein

SCOP Domain Sequences for d2htia1:

Sequence, based on SEQRES records:

>d2htia1 b.45.1.1 (A:10-165) Hypothetical protein BH0577 {Bacillus halodurans [TaxId: 86665]}
eckdekkiteflnkartgflglstndqpyviplnfvwhnhaiyfhgasegrkikmieanp
evcfticedlgtivspvpahtdtaymsviifgtiepvsaieegteamqqmldkyvpgyyh
splaashvekyrsslgsrtaiykiscrertakvnep

Sequence, based on observed residues (ATOM records):

>d2htia1 b.45.1.1 (A:10-165) Hypothetical protein BH0577 {Bacillus halodurans [TaxId: 86665]}
eckdekkiteflnkartgflglstndqpyviplnfvwhnhaiyfhgasegrkikmieanp
evcfticedlaymsviifgtiepvsaieegteamqqmldkyvpslgsrtaiykiscrert
akvnep

Timeline for d2htia1:

• d2htia1 is new in SCOP 1.73
  
• d2htia1 appears in SCOP 1.75
  
• d2htia1 appears in the current release, SCOPe 2.08