SCOPe 2.08: Domain d2hthb1: 2hth B:3-131

Lineage for d2hthb1 (2hth B:3-131)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.12: VPS36 N-terminal domain-like [141442] (1 protein)
   PfamB PB030385

6. Protein Vacuolar protein sorting protein 36, VPS36 [141443] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141444] (1 PDB entry)
   Uniprot Q86VN1 3-131

8. Domain d2hthb1: 2hth B:3-131 [136743]
   Other proteins in same PDB: d2htha_

Details for d2hthb1

PDB Entry: 2hth, 2.7 Å

PDB Description: structural basis for ubiquitin recognition by the human eap45/escrt-ii glue domain

PDB Compounds: (B:) vacuolar protein sorting protein 36

SCOPe Domain Sequences for d2hthb1:

Sequence; same for both SEQRES and ATOM records:

>d2hthb1 b.55.1.12 (B:3-131) Vacuolar protein sorting protein 36, VPS36 {Human (Homo sapiens) [TaxId: 9606]}
rfvwtsglleinetlviqqrgvriydgeekikfdagtlllsthrliwrdqknheccmail
lsqivfieeqaagigksakivvhlhpappnkepgpfqssknsyiklsfkehgqiefyrrl
seemtqrrw

Timeline for d2hthb1:

• d2hthb1 first appeared in SCOP 1.73
  
• d2hthb1 appears in SCOPe 2.07