Lineage for d2ht4f1 (2ht4 F:1-105)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653446Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (40 PDB entries)
  8. 653478Domain d2ht4f1: 2ht4 F:1-105 [136740]
    Other proteins in same PDB: d2ht4d2, d2ht4f2
    automatically matched to d1dqdl1
    complexed with br; mutant

Details for d2ht4f1

PDB Entry: 2ht4 (more details), 3.2 Å

PDB Description: structure of the escherichia coli clc chloride channel y445w mutant and fab complex
PDB Compounds: (F:) Fab fragment, light chain

SCOP Domain Sequences for d2ht4f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ht4f1 b.1.1.1 (F:1-105) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtklei

SCOP Domain Coordinates for d2ht4f1:

Click to download the PDB-style file with coordinates for d2ht4f1.
(The format of our PDB-style files is described here.)

Timeline for d2ht4f1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ht4f2