Lineage for d2ht2f2 (2ht2 F:107-210)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 protein domains)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656503Domain d2ht2f2: 2ht2 F:107-210 [136733]
    Other proteins in same PDB: d2ht2d1, d2ht2f1
    automatically matched to d1dqdl2
    complexed with br; mutant

Details for d2ht2f2

PDB Entry: 2ht2 (more details), 3.32 Å

PDB Description: Structure of the Escherichia coli ClC chloride channel Y445H mutant and Fab complex
PDB Compounds: (F:) Fab fragment, light chain

SCOP Domain Sequences for d2ht2f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ht2f2 b.1.1.2 (F:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d2ht2f2:

Click to download the PDB-style file with coordinates for d2ht2f2.
(The format of our PDB-style files is described here.)

Timeline for d2ht2f2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ht2f1