SCOPe 2.05: Domain d2ht0b_: 2ht0 B:

Lineage for d2ht0b_ (2ht0 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
   automatically mapped to Pfam PF00216

6. Protein Integration host factor beta subunit (IHFB) [88880] (1 species)
   heterodimer of two related subunits

7. Species Escherichia coli [TaxId:562] [88881] (5 PDB entries)

8. Domain d2ht0b_: 2ht0 B: [136729]
   Other proteins in same PDB: d2ht0a_
   automated match to d1ihfb_
   protein/DNA complex; complexed with cd

Details for d2ht0b_

PDB Entry: 2ht0, 2 Å

PDB Description: IHF bound to doubly nicked DNA

PDB Compounds: (B:) Integration host factor beta-subunit

SCOPe Domain Sequences for d2ht0b_:

Sequence; same for both SEQRES and ATOM records:

>d2ht0b_ a.55.1.1 (B:) Integration host factor beta subunit (IHFB) {Escherichia coli [TaxId: 562]}
mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt
grnpktgdkvelegkyvphfkpgkelrdraniy

Timeline for d2ht0b_:

• d2ht0b_ first appeared in SCOP 1.73, called d2ht0b1
  
• d2ht0b_ appears in SCOPe 2.04
  
• d2ht0b_ appears in SCOPe 2.06
  
• d2ht0b_ appears in the current release, SCOPe 2.08