Class a: All alpha proteins [46456] (286 folds) |
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) dimer of identical subunits |
Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins) automatically mapped to Pfam PF00216 |
Protein Integration host factor beta subunit (IHFB) [88880] (1 species) heterodimer of two related subunits |
Species Escherichia coli [TaxId:562] [88881] (5 PDB entries) |
Domain d2ht0b_: 2ht0 B: [136729] Other proteins in same PDB: d2ht0a_ automated match to d1ihfb_ protein/DNA complex; complexed with cd |
PDB Entry: 2ht0 (more details), 2 Å
SCOPe Domain Sequences for d2ht0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ht0b_ a.55.1.1 (B:) Integration host factor beta subunit (IHFB) {Escherichia coli [TaxId: 562]} mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt grnpktgdkvelegkyvphfkpgkelrdraniy
Timeline for d2ht0b_: