Lineage for d2hszb_ (2hsz B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883352Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 1883405Protein automated matches [190691] (3 species)
    not a true protein
  7. 1883406Species Haemophilus somnus [TaxId:205914] [187824] (1 PDB entry)
  8. 1883407Domain d2hszb_: 2hsz B: [136727]
    Other proteins in same PDB: d2hsza1
    automated match to d2hsza1
    complexed with act, cl, unl

Details for d2hszb_

PDB Entry: 2hsz (more details), 1.9 Å

PDB Description: crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution
PDB Compounds: (B:) novel predicted phosphatase

SCOPe Domain Sequences for d2hszb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hszb_ c.108.1.6 (B:) automated matches {Haemophilus somnus [TaxId: 205914]}
gmtqfkligfdldgtlvnslpdlalsinsalkdvnlpqasenlvmtwigngadvlsqrav
dwackqaekeltedefkyfkrqfgfyygenlcnisrlypnvketlealkaqgyilavvtn
kptkhvqpiltafgidhlfsemlggqslpeikphpapfyylcgkfglypkqilfvgdsqn
difaahsagcavvgltygynynipiaqskpdwifddfadilkitq

SCOPe Domain Coordinates for d2hszb_:

Click to download the PDB-style file with coordinates for d2hszb_.
(The format of our PDB-style files is described here.)

Timeline for d2hszb_: