SCOPe 2.03: Domain d2hszb_: 2hsz B:

Lineage for d2hszb_ (2hsz B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein automated matches [190691] (2 species)
   not a true protein

7. Species Haemophilus somnus [TaxId:205914] [187824] (1 PDB entry)

8. Domain d2hszb_: 2hsz B: [136727]
   Other proteins in same PDB: d2hsza1
   automated match to d2hsza1
   complexed with act, cl, unl

Details for d2hszb_

PDB Entry: 2hsz, 1.9 Å

PDB Description: crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution

PDB Compounds: (B:) novel predicted phosphatase

SCOPe Domain Sequences for d2hszb_:

Sequence; same for both SEQRES and ATOM records:

>d2hszb_ c.108.1.6 (B:) automated matches {Haemophilus somnus [TaxId: 205914]}
gmtqfkligfdldgtlvnslpdlalsinsalkdvnlpqasenlvmtwigngadvlsqrav
dwackqaekeltedefkyfkrqfgfyygenlcnisrlypnvketlealkaqgyilavvtn
kptkhvqpiltafgidhlfsemlggqslpeikphpapfyylcgkfglypkqilfvgdsqn
difaahsagcavvgltygynynipiaqskpdwifddfadilkitq

Timeline for d2hszb_:

• d2hszb_ first appeared in SCOP 1.73, called d2hszb1
  
• d2hszb_ appears in SCOPe 2.02
  
• d2hszb_ appears in SCOPe 2.04
  
• d2hszb_ appears in the current release, SCOPe 2.08, called d2hszb2