SCOP 1.73: Domain d2hszb1: 2hsz B:1-224

Lineage for d2hszb1 (2hsz B:1-224)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (9 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein Phosphoglycolate phosphatase Gph [142143] (1 species)

7. Species Haemophilus somnus [TaxId:731] [142144] (1 PDB entry)

8. Domain d2hszb1: 2hsz B:1-224 [136727]
   automatically matched to 2HSZ A:1-224
   complexed with act, cl, unl

Details for d2hszb1

PDB Entry: 2hsz, 1.9 Å

PDB Description: crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution

PDB Compounds: (B:) novel predicted phosphatase

SCOP Domain Sequences for d2hszb1:

Sequence; same for both SEQRES and ATOM records:

>d2hszb1 c.108.1.6 (B:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]}
mtqfkligfdldgtlvnslpdlalsinsalkdvnlpqasenlvmtwigngadvlsqravd
wackqaekeltedefkyfkrqfgfyygenlcnisrlypnvketlealkaqgyilavvtnk
ptkhvqpiltafgidhlfsemlggqslpeikphpapfyylcgkfglypkqilfvgdsqnd
ifaahsagcavvgltygynynipiaqskpdwifddfadilkitq

Timeline for d2hszb1:

• d2hszb1 is new in SCOP 1.73
  
• d2hszb1 appears in SCOP 1.75
  
• d2hszb1 appears in the current release, SCOPe 2.08, called d2hszb2