Lineage for d2hsza1 (2hsz A:1-224)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1628591Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1628592Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1628719Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 1628766Protein Phosphoglycolate phosphatase Gph [142143] (1 species)
  7. 1628767Species Haemophilus somnus [TaxId:731] [142144] (1 PDB entry)
    Uniprot Q0I1W8 1-224
  8. 1628768Domain d2hsza1: 2hsz A:1-224 [136726]
    Other proteins in same PDB: d2hszb_
    complexed with act, cl, unl

Details for d2hsza1

PDB Entry: 2hsz (more details), 1.9 Å

PDB Description: crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution
PDB Compounds: (A:) novel predicted phosphatase

SCOPe Domain Sequences for d2hsza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]}
mtqfkligfdldgtlvnslpdlalsinsalkdvnlpqasenlvmtwigngadvlsqravd
wackqaekeltedefkyfkrqfgfyygenlcnisrlypnvketlealkaqgyilavvtnk
ptkhvqpiltafgidhlfsemlggqslpeikphpapfyylcgkfglypkqilfvgdsqnd
ifaahsagcavvgltygynynipiaqskpdwifddfadilkitq

SCOPe Domain Coordinates for d2hsza1:

Click to download the PDB-style file with coordinates for d2hsza1.
(The format of our PDB-style files is described here.)

Timeline for d2hsza1: