![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins) the insertion subdomain is a 4-helical bundle |
![]() | Protein Phosphoglycolate phosphatase Gph [142143] (1 species) |
![]() | Species Haemophilus somnus [TaxId:731] [142144] (1 PDB entry) Uniprot Q0I1W8 1-224 |
![]() | Domain d2hsza1: 2hsz A:1-224 [136726] Other proteins in same PDB: d2hsza2, d2hszb2, d2hszb3 complexed with act, cl, unl |
PDB Entry: 2hsz (more details), 1.9 Å
SCOPe Domain Sequences for d2hsza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} mtqfkligfdldgtlvnslpdlalsinsalkdvnlpqasenlvmtwigngadvlsqravd wackqaekeltedefkyfkrqfgfyygenlcnisrlypnvketlealkaqgyilavvtnk ptkhvqpiltafgidhlfsemlggqslpeikphpapfyylcgkfglypkqilfvgdsqnd ifaahsagcavvgltygynynipiaqskpdwifddfadilkitq
Timeline for d2hsza1: