Lineage for d2hsha_ (2hsh A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876344Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries)
  8. 2876350Domain d2hsha_: 2hsh A: [136724]
    automated match to d1erv__
    complexed with po4; mutant

Details for d2hsha_

PDB Entry: 2hsh (more details), 1.35 Å

PDB Description: crystal structure of c73s mutant of human thioredoxin-1 oxidized with h2o2
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2hsha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hsha_ c.47.1.1 (A:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasecevksmptfqffkkgqkvgefsgankekleatinelv

SCOPe Domain Coordinates for d2hsha_:

Click to download the PDB-style file with coordinates for d2hsha_.
(The format of our PDB-style files is described here.)

Timeline for d2hsha_: