SCOPe 2.07: Domain d2hsga2: 2hsg A:61-332

Lineage for d2hsga2 (2hsg A:61-332)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species)

7. Species Bacillus megaterium [TaxId:1404] [117741] (10 PDB entries)
   Uniprot P46828 58-322 ! Uniprot P46828

8. Domain d2hsga2: 2hsg A:61-332 [136723]
   Other proteins in same PDB: d2hsga1
   automated match to d1rzra2

Details for d2hsga2

PDB Entry: 2hsg, 2.5 Å

PDB Description: Structure of transcription regulator CcpA in its DNA-free state

PDB Compounds: (A:) Glucose-resistance amylase regulator

SCOPe Domain Sequences for d2hsga2:

Sequence, based on SEQRES records:

>d2hsga2 c.93.1.1 (A:61-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
ttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgi
ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
amrlltkymnketvdssivqlphriefrqstk

Sequence, based on observed residues (ATOM records):

>d2hsga2 c.93.1.1 (A:61-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
ttvgviipsnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgiif
msgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkniaf
vsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekpta
ifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigavam
rlltkymnketvdssivqlphriefrqstk

Timeline for d2hsga2:

• d2hsga2 first appeared in SCOP 1.73
  
• d2hsga2 appears in SCOPe 2.06
  
• d2hsga2 appears in the current release, SCOPe 2.08