Lineage for d2hsga2 (2hsg A:61-332)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143710Family c.93.1.1: L-arabinose binding protein-like [53823] (18 protein domains)
  6. 2143756Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species)
  7. 2143757Species Bacillus megaterium [TaxId:1404] [117741] (10 PDB entries)
    Uniprot P46828 58-322 ! Uniprot P46828
  8. 2143768Domain d2hsga2: 2hsg A:61-332 [136723]
    Other proteins in same PDB: d2hsga1
    automated match to d1rzra2

Details for d2hsga2

PDB Entry: 2hsg (more details), 2.5 Å

PDB Description: Structure of transcription regulator CcpA in its DNA-free state
PDB Compounds: (A:) Glucose-resistance amylase regulator

SCOPe Domain Sequences for d2hsga2:

Sequence, based on SEQRES records: (download)

>d2hsga2 c.93.1.1 (A:61-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
ttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgi
ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
amrlltkymnketvdssivqlphriefrqstk

Sequence, based on observed residues (ATOM records): (download)

>d2hsga2 c.93.1.1 (A:61-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
ttvgviipsnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgiif
msgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkniaf
vsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekpta
ifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigavam
rlltkymnketvdssivqlphriefrqstk

SCOPe Domain Coordinates for d2hsga2:

Click to download the PDB-style file with coordinates for d2hsga2.
(The format of our PDB-style files is described here.)

Timeline for d2hsga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hsga1