Lineage for d2hs4a4 (2hs4 A:508-603)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1041476Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 1041477Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) (S)
  5. 1041478Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)
  6. 1041493Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 1041494Species Thermotoga maritima [TaxId:2336] [103261] (7 PDB entries)
    TM1246
  8. 1041502Domain d2hs4a4: 2hs4 A:508-603 [136719]
    Other proteins in same PDB: d2hs4a1, d2hs4a2
    automatically matched to d1vk3a4
    complexed with acp, fgr, mg, po4

Details for d2hs4a4

PDB Entry: 2hs4 (more details), 2.7 Å

PDB Description: T. maritima PurL complexed with FGAR and AMPPCP
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOPe Domain Sequences for d2hs4a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hs4a4 d.139.1.1 (A:508-603) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
akpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglki
evklpevrpahqmvlvfsertpvvdvpvkeigtlsr

SCOPe Domain Coordinates for d2hs4a4:

Click to download the PDB-style file with coordinates for d2hs4a4.
(The format of our PDB-style files is described here.)

Timeline for d2hs4a4: